PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01003178G0150
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family M-type_MADS
Protein Properties Length: 86aa    MW: 9760.32 Da    PI: 11.8297
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01003178G0150genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF82.92e-261160251
                     ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                     rie+k  rqv fskRr+g++KKA+EL  LCdaeva+++fs+ gklyeyss
  PH01003178G0150 11 RIEDKASRQVRFSKRRAGLFKKAFELALLCDAEVALLVFSPAGKLYEYSS 60
                     8***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006628.735262IPR002100Transcription factor, MADS-box
SMARTSM004329.3E-33261IPR002100Transcription factor, MADS-box
CDDcd002653.94E-32358No hitNo description
SuperFamilySSF554552.35E-27475IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-27424IPR002100Transcription factor, MADS-box
PfamPF003198.8E-261158IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-272439IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-273960IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 86 aa     Download sequence    Send to blast
MARRGRVQLR RIEDKASRQV RFSKRRAGLF KKAFELALLC DAEVALLVFS PAGKLYEYSS  60
SSRSARARHV LETISQRRTT LHDPV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_A3e-18462260MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B3e-18462260MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C3e-18462260MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_D3e-18462260MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3kov_A3e-18462260Myocyte-specific enhancer factor 2A
3kov_B3e-18462260Myocyte-specific enhancer factor 2A
3kov_I3e-18462260Myocyte-specific enhancer factor 2A
3kov_J3e-18462260Myocyte-specific enhancer factor 2A
3mu6_A2e-18462260Myocyte-specific enhancer factor 2A
3mu6_B2e-18462260Myocyte-specific enhancer factor 2A
3mu6_C2e-18462260Myocyte-specific enhancer factor 2A
3mu6_D2e-18462260Myocyte-specific enhancer factor 2A
3p57_A3e-18462260Myocyte-specific enhancer factor 2A
3p57_B3e-18462260Myocyte-specific enhancer factor 2A
3p57_C3e-18462260Myocyte-specific enhancer factor 2A
3p57_D3e-18462260Myocyte-specific enhancer factor 2A
3p57_I3e-18462260Myocyte-specific enhancer factor 2A
3p57_J3e-18462260Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF1848193e-74KF184819.1 Saccharum hybrid cultivar R570 clone BAC 004J16 complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004971093.14e-36PREDICTED: truncated transcription factor CAULIFLOWER D-like
SwissprotQ388388e-26AGL14_ARATH; Agamous-like MADS-box protein AGL14
SwissprotQ9XJ601e-25MAD50_ORYSJ; MADS-box transcription factor 50
TrEMBLA0A0E0JSY64e-41A0A0E0JSY6_ORYPU; Uncharacterized protein
STRINGORGLA01G0361900.11e-36(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP12938398
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45660.14e-25AGAMOUS-like 20